Please enable JavaScript in your browser. 

Important Announcement


DrugPortal is moving to PubChem in December 2022.
Please see the NLM Technical Bulletin article for more information.

Skip to main content
Drug Information Portal National Library of Medicine
       Home    Substance
1 result for Name/Synonym equals LIXISENATIDE 
Drug Name: Lixisenatide [USAN:INN] View Structure
Description: A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A). 

Site Map, Contact Us, Copyright, Privacy, Accessibility
U.S. National Library of Medicine, 8600 Rockville Pike, Bethesda, MD 20894
National Institutes of Health, Health & Human Services
Freedom of Information Act
HHS Vulnerability Disclosure
Drug Information Portal Mobile Site
Last updated: Nov 2022