Please enable JavaScript in your browser. 
Skip to main content
Drug Information Portal National Library of Medicine
       Home    Substance
1 result for Name/Synonym equals LIXISENATIDE 
Drug Name: Lixisenatide [USAN:INN] View Structure
Description: A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A). 

Site Map, Contact Us, Copyright, Privacy, Accessibility
U.S. National Library of Medicine, 8600 Rockville Pike, Bethesda, MD 20894
National Institutes of Health, Health & Human Services
Freedom of Information Act
Drug Information Portal Mobile Site
Last updated: May 2021